PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG153600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 195aa    MW: 21022.9 Da    PI: 9.981
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG153600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.95.5e-182466345
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                         i++  +  vtfskR+ g lKK +ELS LC+++va iifs+tgk
  Pavir.3NG153600.1.p 24 IKDRARLMVTFSKRKSGFLKKTSELSLLCGVDVAAIIFSPTGK 66
                         8899999***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.5961474IPR002100Transcription factor, MADS-box
SMARTSM004325.1E-191473IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-201586IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-131636IPR002100Transcription factor, MADS-box
PfamPF003196.8E-202470IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-133651IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-135172IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVAPPRGTGR KKSQGRKPTE VALIKDRARL MVTFSKRKSG FLKKTSELSL LCGVDVAAII  60
FSPTGKPSAF GDSSVDHVLR LYVPLPAGDE DGPGSGFPDD ATDGDERGAV EATARRKEVA  120
MARVAEEEAR MSAVGEKVLR AAAGRVWWEA DVEALGAEEL HEFARALRRL RDNVRRHADK  180
LPPAHASQPT TQLQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962402.14e-80PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK3Z9971e-77K3Z997_SETIT; Uncharacterized protein
STRINGSi023118m4e-77(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-18AGAMOUS-like 62